PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P04490_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 228aa    MW: 26073.7 Da    PI: 9.0696
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P04490_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.1e-1980134256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq++ Le+ F+++++++++++++LA++l++++rqV vWFqNrRa+ k
  GSMUA_Achr2P04490_001  80 RKKLKLTKEQVTLLEDRFREHNTLNTAQKQDLADRLNIQTRQVEVWFQNRRARTK 134
                            788899***********************************************98 PP

2HD-ZIP_I/II112.72.4e-3680168189
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk++l+keqv+lLE+ F+e+++L++ +K++la +L++q+rqv+vWFqnrRARtk+k++E+dye Lk+++++l++en+rL+ke +eLr
  GSMUA_Achr2P04490_001  80 RKKLKLTKEQVTLLEDRFREHNTLNTAQKQDLADRLNIQTRQVEVWFQNRRARTKLKKIEVDYECLKKWCESLSDENRRLKKELQELR 167
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 e 89 
                            +
  GSMUA_Achr2P04490_001 168 S 168
                            6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.72E-1772136IPR009057Homeodomain-like
PROSITE profilePS5007116.66576136IPR001356Homeobox domain
SMARTSM003892.3E-1578140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1680134IPR009057Homeodomain-like
CDDcd000863.21E-1380137No hitNo description
PfamPF000465.1E-1680134IPR001356Homeobox domain
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PfamPF021836.7E-9136168IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-15136179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAEEECNTNL SLAIDGGRQF MPGHRSKPTL HLQVLFPHHP KEEEEEEPIR IPRSKNTEEE  60
EVISGRDTSN CSNDKLFGTR KKLKLTKEQV TLLEDRFREH NTLNTAQKQD LADRLNIQTR  120
QVEVWFQNRR ARTKLKKIEV DYECLKKWCE SLSDENRRLK KELQELRSAN PGSPFYMHLL  180
KAATLTICPS CERMAAIGGG AAGKSTSAFD GMKGQLVPVK NGLLSRRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386832.11e-170PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotQ8GRL41e-51HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
SwissprotA2XE761e-51HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
TrEMBLM0S5401e-170M0S540_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04490_0011e-170(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-50homeobox from Arabidopsis thaliana